Golden Hamster Tumor Necrosis Factor Alpha Protein

Golden Hamster Tumor Necrosis Factor alpha protein purified from transient expression in HEK.  Mature protein represents the secretory region of TNFa from amino acids 79-233 of XP_005086856; Uniprot A0A1U7RE37 and includes and flag tag and a 6x his tag on the C-terminal end.

Molecular Weight 19.0 kDa

Sequence of Mature Protein

RSSSQNSNDKPVAHVVANHQVEEQLEWLSHRANALLANGMSL

KDNQLVIPADGLYLVYSQVLFRGQGCPSYVLLTHTVSRIAVSYEDNVNLLSAIKSPCPKE

TPEGEELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIALDYKDDDDKHHHHHH           

Click here for a sample data sheet