Golden Hamster Tumor Necrosis Factor Alpha Protein
Golden Hamster Tumor Necrosis Factor alpha protein purified from transient expression in HEK. Mature protein represents the secretory region of TNFa from amino acids 79-233 of XP_005086856; Uniprot A0A1U7RE37 and includes and flag tag and a 6x his tag on the C-terminal end.
Molecular Weight 19.0 kDa
Sequence of Mature Protein
RSSSQNSNDKPVAHVVANHQVEEQLEWLSHRANALLANGMSL
KDNQLVIPADGLYLVYSQVLFRGQGCPSYVLLTHTVSRIAVSYEDNVNLLSAIKSPCPKE
TPEGEELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIALDYKDDDDKHHHHHH
Click here for a sample data sheet