Golden Hamster Tumor Necrosis Factor Alpha Protein

Golden Hamster Tumor Necrosis Factor Alpha Protein

  • $ 750.00
    Unit price per 


Golden Hamster Tumor Necrosis Factor alpha protein purified from transient expression in HEK.  Mature protein represents the secretory region of TNFa from amino acids 79-233 of XP_005086856; Uniprot A0A1U7RE37 and includes and flag tag and a 6x his tag on the C-terminal end.

Molecular Weight 19.0 kDa

Sequence of Mature Protein

RSSSQNSNDKPVAHVVANHQVEEQLEWLSHRANALLANGMSL

KDNQLVIPADGLYLVYSQVLFRGQGCPSYVLLTHTVSRIAVSYEDNVNLLSAIKSPCPKE

TPEGEELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIALDYKDDDDKHHHHHH           

Click here for a sample data sheet