
Guinea Pig Interleukin 17 Protein
Guinea Pig (Cavia porcellus) Interleukin 17A protein. This protein was purified from transient expression in Human embryonic kidney 293 cells. The mature protein represents amino acids 25-158 of NP_001265697.1; Uniprot A0A286XFR9 and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end. Two distinct bands of approximately 5kDa difference in size are observed on reduced SDS-Page due to a heterogeneous population of N-linked glycosylated protein.
Molecular Weight 15.8 kDa
Sequence of Mature Protein
GIPIPRNPGCPTATEGKNFLQNVKLNLSIFNPLTQN
VNSRRSSDYYKRSTSPWTLHRNENPNRYPPVIWEAECRYSGCVNAAGKEDHHVSSVPIQQ
EILVLQREPQNCPLSFRLEKMKVTVGCTCVTPIVRHVG LEVLFQ