Guinea Pig Interleukin 2 Protein

Guinea Pig (Cavia porcellus) Interleukin 2 protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  The mature protein represents amino acids 21-152 of Uniprot H0VBY4_CAVPO and includes six amino acids from a HRV3C cleavage site on the C-terminal end.

Molecular Weight 15.8 kDa  

Sequence of Mature Protein

APTSSSPKQTQDRLELLLRDLQTLLEGVTSNPRLPKMLKL

KLYPPKMVSELQHLQCLEEELRAVEQVLNLAEHKNFPLIHTKDFISNINVTVLSLKGSET

AFVCDLEDESVNIVEFLKRWIAFCQKIMSRLTLEVLFQ

Click here for a sample data sheet