Guinea Pig Interleukin 6 Protein

Guinea Pig (Cavia porcellus) Interleukin 6 protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  The mature protein represents amino acids 25-233 of XP_013007853 and includes a flag tag and 6x His tag on the C terminal end. 

Molecular Weight 27.3 kDa

Interleukin 6 has two predicted N-linked glycosylation sites and an O-linked glycosylation sites that contribute to a larger band size than 27 kDa when visualized by SDS-Page.

Sequence of Mature Protein

FPTAQVQHDFTADTTDEMTTAEMTTTMPNKPTTSASQVFQMFMRVYQAVKELKNEMNKHNVEKAI

LNNLDLPKLKLEDGCFFNGYNWETCQLKITPGLFKFQTYLQSMQNKLQNESENKKAANIYAGIKSLSL

FMKSKINNTEQMEFLSPTPDATLLEKLETQSQTQMLLIAEIVLQRLEEFLQDSLRAIRKADWEGRN     

Click here for a sample data sheet