Guinea Pig Interleukin 8 Protein

Guinea Pig (Cavia porcellus) Interleukin 8 protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  The mature protein represents amino acids 21-101 of NP_001166870.1; Uniprot P49113 and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end.  

Molecular Weight 10 kDa

Sequence of Mature Protein           

EGMVVTKLVSELRCQCIKIHTTPFHPKFIKELKVIESGPRCANSEIIVKL

SDNRQLCLDPKKKWVQDVVSMFLKRTESQDS

LEVLFQ

Click here for a sample data sheet