Guinea Pig Interleukin 8 Protein
Guinea Pig (Cavia porcellus) Interleukin 8 protein. This protein was purified from transient expression in Human embryonic kidney 293 cells. The mature protein represents amino acids 21-101 of NP_001166870.1; Uniprot P49113 and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end.
Molecular Weight 10 kDa
Sequence of Mature Protein
EGMVVTKLVSELRCQCIKIHTTPFHPKFIKELKVIESGPRCANSEIIVKL
SDNRQLCLDPKKKWVQDVVSMFLKRTESQDS
LEVLFQ