Guinea Pig Tumor Necrosis Factor Alpha Protein

Guinea Pig (Cavia porcellus) Tumor Necrosis Factor Alpha (TNFa) protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  The mature protein represents the secretory portion of TNFa from amino acids 80-234 of NP_001166496.1; Uniprot P51435 and includes a flag tag and 6x his tag on the C-terminal end. 

Molecular Weight 18.9 kDa

Sequence of Mature Protein           

RSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMGLSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQKETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIALDYKDDDDKHHHHHH

Click here for a sample data sheet