GlycoScientific
Guinea Pig Interleukin 23 Protein
Guinea Pig Interleukin 23 Protein
Guinea Pig (Cavia porcellus) Interleukin 23 protein. This protein was purified from transient expression in Human embryonic kidney 293 cells. Mature IL23 is a heterodimeric protein consisting of the IL23a (p19) subunit Uniprot Q6LA37; NCBI NP_001166440.1 and the IL12b (p40) subunit Uniprot Q924V5; NCBI NP_001166438.1. and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end.
Molecular Weight 57 kDa
IL23 is broken into its subunits when reduced as can be seen in the gel to the left. Glycosylation and truncated protein products result in extra bands.
P19 IL23α subunit-18.5kDa
P40 IL12β subunit-36 kDa
Sequence of Mature Protein
MWELKKDVYVVELDWHTDAPGETVVLTCNTAEEDGITWTSDRKSDILGSGKTLTIQVKEFEDAGGYTCHKGGEVLSRSQLLLHKKEDEIWSTDILKEQKGSNGKTFLKCEARSYSGRFTCWWLTAFGTDVKFSVKGSRGSSDPSGVTCGEAERVSGDNQEYKYSVECQEDSACPTAEESLPIEVVVDAIHKFKYENYTSSFYIRDIIKPDPPKNLQLKPSVNSQQVEVSWEYPDTWSTPHSYFSLTFLVQTHGKNKNRREKKYELFTDKTSATVSCHKISKVEVRARDRYYSSSWSEWASVSCSEVSVSRENLYFQSGSGSSRGGSGSGGSGGGGSKLVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTPLEVLFQ
Couldn't load pickup availability
This product is intended exclusively for scientific investigation or laboratory research and is not intended for diagnostic, therapeutic, or human/animal clinical use.
Share
