Skip to product information
1 of 1

GlycoScientific

Guinea Pig Interleukin 23 Protein

Guinea Pig Interleukin 23 Protein

Guinea Pig (Cavia porcellus) Interleukin 23 protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  Mature IL23 is a heterodimeric protein consisting of the IL23a (p19) subunit Uniprot Q6LA37; NCBI NP_001166440.1 and the IL12b (p40) subunit Uniprot Q924V5; NCBI NP_001166438.1. and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end.  

Molecular Weight 57 kDa

IL23 is broken into its subunits when reduced as can be seen in the gel to the left.  Glycosylation and truncated protein products result in extra bands.

P19 IL23α subunit-18.5kDa

P40 IL12β subunit-36 kDa 

 

Sequence of Mature Protein           

MWELKKDVYVVELDWHTDAPGETVVLTCNTAEEDGITWTSDRKSDILGSGKTLTIQVKEFEDAGGYTCHKGGEVLSRSQLLLHKKEDEIWSTDILKEQKGSNGKTFLKCEARSYSGRFTCWWLTAFGTDVKFSVKGSRGSSDPSGVTCGEAERVSGDNQEYKYSVECQEDSACPTAEESLPIEVVVDAIHKFKYENYTSSFYIRDIIKPDPPKNLQLKPSVNSQQVEVSWEYPDTWSTPHSYFSLTFLVQTHGKNKNRREKKYELFTDKTSATVSCHKISKVEVRARDRYYSSSWSEWASVSCSEVSVSRENLYFQSGSGSSRGGSGSGGSGGGGSKLVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTPLEVLFQ

Click here for a sample data sheet.

Regular price $ 750.00 USD
Regular price Sale price $ 750.00 USD
Sale Sold out
Size
Quantity

This product is intended exclusively for scientific investigation or laboratory research and is not intended for diagnostic, therapeutic, or human/animal clinical use.

View full details